Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine PDGFB protein (PDGFB), Partial

This Recombinant Bovine PDGFB protein (PDGFB), Partial spans the amino acid sequence from region 82-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

B1H0W5

Expression Region

82-190aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVVARAVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5F Antibody - N-terminal region
MBS3212064-01 0.1 mL

INPP5F Antibody - N-terminal region

Sign In for Pricing
View Details
INPP5F Antibody - N-terminal region
MBS3212064-02 5x 0.1 mL

INPP5F Antibody - N-terminal region

Sign In for Pricing
View Details
14 Types of HPV Nucleic Acid Typing Detection Kit (Fluorescence PCR)
HWTS-CC012A 1 Kit

14 Types of HPV Nucleic Acid Typing Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
Mouse Monoclonal CD34 Antibody (QBEnd/10) [DyLight 594]
NBP2-32932DL594 0.1 mL

Mouse Monoclonal CD34 Antibody (QBEnd/10) [DyLight 594]

Sign In for Pricing
View Details
PIK3C2B Protein Vector (Rat) (pPB-C-His)
PV294046 500 ng

PIK3C2B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Protein G - 50nm Gold Conjugate
AC-50-18 1 mL

Protein G - 50nm Gold Conjugate

Sign In for Pricing
View Details