Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Single-strand DNA-binding protein (virE2), partial

This Recombinant Agrobacterium tumefaciens Single-strand DNA-binding protein (virE2), partial spans the amino acid sequence from region 316-533aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A3W9

Expression Region

316-533aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Agrobacterium tumefaciens (strain 15955)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NRAHNRQFPTATVNMGQQPDGQGGLTRDRHVSVEFLMQSAPNSPWAQALKKGELWDRVQLLARDGNRYLSPHRLEYSDPEHFTELMNRVGLPASMGRQSHAASIKFEKFDAQAAVIVINGPELRDIHDLSPENLQNVSTKDVIVADRNENGQRTGTYTSVAEYERLQLRLPADAAGVLGEAADKYSRDFVRPEPASRPISDSRRIYESRPRSQSVNSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TLR8 Antibody (44C143) [DyLight 405]
NBP2-24917V 0.1 mL

Mouse Monoclonal TLR8 Antibody (44C143) [DyLight 405]

Sign In for Pricing
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 490)
MBS6245297-01 0.1 mL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 490)

Sign In for Pricing
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 490)
MBS6245297-02 5x 0.1 mL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (MaxLight 490)

Sign In for Pricing
View Details
FLJ20972 Human shRNA Lentiviral Particle (Locus ID 80098)
TL307318V 500 µL Each

FLJ20972 Human shRNA Lentiviral Particle (Locus ID 80098)

Sign In for Pricing
View Details
Mouse E-selectin ELISA Kit
orb408830-01 24 Tests

Mouse E-selectin ELISA Kit

Sign In for Pricing
View Details
Mouse E-selectin ELISA Kit
orb408830-02 48 Tests

Mouse E-selectin ELISA Kit

Sign In for Pricing
View Details