Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2), partial

This Recombinant Influenza A virus Matrix protein 2 (M2), partial spans the amino acid sequence from region 1-22aa&44-97aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A088G224

Expression Region

1-22aa&44-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Influenza A virus (A/New York/WC-LVD-14-006/2014 (H1N1) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETPTRSEWECRCSGSGGGGSGGGGSDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA00829-25T - Human HOMER1 Primer Pair 2
OOCA00829-25T 25 Tests

OOCA00829-25T - Human HOMER1 Primer Pair 2

Sign In for Pricing
View Details
SLC25A25 (Solute Carrier Family 25 Member 25, Small Calcium-binding Mitochondrial Carrier Protein 2, MCSC, PCSCL, SCAMC-2) (AP)
MBS6437903-01 0.1 mL

SLC25A25 (Solute Carrier Family 25 Member 25, Small Calcium-binding Mitochondrial Carrier Protein 2, MCSC, PCSCL, SCAMC-2) (AP)

Sign In for Pricing
View Details
SLC25A25 (Solute Carrier Family 25 Member 25, Small Calcium-binding Mitochondrial Carrier Protein 2, MCSC, PCSCL, SCAMC-2) (AP)
MBS6437903-02 5x 0.1 mL

SLC25A25 (Solute Carrier Family 25 Member 25, Small Calcium-binding Mitochondrial Carrier Protein 2, MCSC, PCSCL, SCAMC-2) (AP)

Sign In for Pricing
View Details
DPYSL2 Protein Vector (Mouse) (pPB-C-His)
PV173366 500 ng

DPYSL2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NMDAε3 (P986) polyclonal antibody
orb644096-01 25 µL

NMDAε3 (P986) polyclonal antibody

Sign In for Pricing
View Details
NMDAε3 (P986) polyclonal antibody
orb644096-02 50 μL

NMDAε3 (P986) polyclonal antibody

Sign In for Pricing
View Details