Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Pro-epidermal growth factor (EGF), Partial

This Recombinant Chicken Pro-epidermal growth factor (EGF), Partial spans the amino acid sequence from region 1026-1080aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6PPB4

Expression Region

1026-1080aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodium (Rh) ICP Standard Solution 1.0 gm/L In 2% HNO3 Traceable To NIST -1000 ppm 2% v/v Nitric Acid
ICP163 00125 125 mL

Rhodium (Rh) ICP Standard Solution 1.0 gm/L In 2% HNO3 Traceable To NIST -1000 ppm 2% v/v Nitric Acid

Sign In for Pricing
View Details
Anti-BMH1 Polyclonal Antibody
AB2C052 0.1mg

Anti-BMH1 Polyclonal Antibody

Sign In for Pricing
View Details
OR5T3 Antibody
E19-10256-2 100 µg -100 µL

OR5T3 Antibody

Sign In for Pricing
View Details
CCDC83 Rabbit Polyclonal Antibody (HRP)
orb467810 100 µL

CCDC83 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-KRT8 Antibody (6W904)
TMAC-00874-01 50 μL

Anti-KRT8 Antibody (6W904)

Sign In for Pricing
View Details
Anti-KRT8 Antibody (6W904)
TMAC-00874-02 100 µL

Anti-KRT8 Antibody (6W904)

Sign In for Pricing
View Details