Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Platelet derived growth factor subunit B (PDGF-B), partial

This Recombinant Chicken Platelet derived growth factor subunit B (PDGF-B), partial spans the amino acid sequence from region 68-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q90W23

Expression Region

68-197aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLDLNATQPSQNHVSLSRERRSLDALAAAEPAVLAECKTRTVVFEISRDMVDSTNANFVVWPPCVEVQRCSGCCNNRNVQCRPMQIRVRHVQVNKIEFFQRKPIFKKVIVPLEDHVQCRCEVVSRPPPRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C. rugosa Lipase 03, CRL 3 from Candida rugosa - ELCR03
EC179313-01 0.1 g

C. rugosa Lipase 03, CRL 3 from Candida rugosa - ELCR03

Sign In for Pricing
View Details
C. rugosa Lipase 03, CRL 3 from Candida rugosa - ELCR03
EC179313-02 1 g

C. rugosa Lipase 03, CRL 3 from Candida rugosa - ELCR03

Sign In for Pricing
View Details
Washer For 5 mm
1219890 1 Unit

Washer For 5 mm

Sign In for Pricing
View Details
NSBP1 Rabbit Polyclonal Antibody (Biotin)
orb2130013 100 µL

NSBP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Bottle, Wide Mouth, Square, PP
7161000 6/Bag

Bottle, Wide Mouth, Square, PP

Sign In for Pricing
View Details
Fetuin A Antibody, mAb, Rabbit
A04946-100 100 µL

Fetuin A Antibody, mAb, Rabbit

Sign In for Pricing
View Details