Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related C3 botulinum toxin substrate 1 (RAC1)

This Recombinant Human Ras-related C3 botulinum toxin substrate 1 (RAC1) spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell migration-inducing gene 5 protein; Ras-like protein TC25; p21-Rac1

UniProt

P63000

Expression Region

1-208aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCL16/HCC-4 Protein, N-GST
HT275012-01 50 µg

Recombinant Human CCL16/HCC-4 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CCL16/HCC-4 Protein, N-GST
HT275012-02 100 µg

Recombinant Human CCL16/HCC-4 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CCL16/HCC-4 Protein, N-GST
HT275012-03 1 mg

Recombinant Human CCL16/HCC-4 Protein, N-GST

Sign In for Pricing
View Details
WNK3 Antibody
A73058-100UL 100 µL

WNK3 Antibody

Sign In for Pricing
View Details
Catalase (CAT) Fish ELISA Kit
95394 96 Tests

Catalase (CAT) Fish ELISA Kit

Sign In for Pricing
View Details
LMOD1 (Leiomodin 1, Leiomodin-1, 64kD Autoantigen 1D, 64kD Autoantigen 1D3, 64kD Autoantigen D1, FLJ55689, Leiomodin Muscle Form, Smooth Muscle Leiomodin, SM-Lmod, Thyroid-associated Ophthalmopathy Autoantigen) (MaxLight 490) discontinued
L3190-50-ML490 100 µL

LMOD1 (Leiomodin 1, Leiomodin-1, 64kD Autoantigen 1D, 64kD Autoantigen 1D3, 64kD Autoantigen D1, FLJ55689, Leiomodin Muscle Form, Smooth Muscle Leiomodin, SM-Lmod, Thyroid-associated Ophthalmopathy Autoantigen) (MaxLight 490) discontinued

Sign In for Pricing
View Details