Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LIM and SH3 domain protein 1 (LASP1)

This Recombinant Human LIM and SH3 domain protein 1 (LASP1) spans the amino acid sequence from region 1-261aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LASP-1; Metastatic lymph node gene 50 protein; MLN 50

UniProt

Q14847

Expression Region

1-261aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCmL1 (NM_001037540) Human Recombinant Protein
TP312954M 100 µg

SCmL1 (NM_001037540) Human Recombinant Protein

Sign In for Pricing
View Details
3300002I08Rik Mouse Gene Knockout Kit (CRISPR)
KN500320 1 Kit

3300002I08Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Rabbit Polyclonal Antibody
AP06443PU-N 100 µg

Nkx3.1 (NKX3-1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF32 (NM_001184996) Human Over-expression Lysate
LC432940 20 µg

RNF32 (NM_001184996) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details