Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sus scrofa Platelet-derived growth factor subunit B

This Recombinant Sus scrofa Platelet-derived growth factor subunit B spans the amino acid sequence from region 21-240aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A8D1VN34

Expression Region

21-240aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDRADLDLNLTRSHSGGELESLSRGRRSLGSPTVAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVARPVTRSPGSSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETLGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2C19 Blocking Peptide
33R-7517 0.1 mg

CYP2C19 Blocking Peptide

Sign In for Pricing
View Details
ADRBK1 (Beta-Adrenergic Receptor Kinase 1, BARK1, BETA-ARK1, FLJ16718, GRK2) discontinued
209416-01 20 µL

ADRBK1 (Beta-Adrenergic Receptor Kinase 1, BARK1, BETA-ARK1, FLJ16718, GRK2) discontinued

Sign In for Pricing
View Details
ADRBK1 (Beta-Adrenergic Receptor Kinase 1, BARK1, BETA-ARK1, FLJ16718, GRK2) discontinued
209416-02 100 µL

ADRBK1 (Beta-Adrenergic Receptor Kinase 1, BARK1, BETA-ARK1, FLJ16718, GRK2) discontinued

Sign In for Pricing
View Details
Anti-RP2 Antibody Picoband®, APC Conjugate
A01923-1-APC 100 µg/Vial

Anti-RP2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
AUP1, CT (AUP1, Ancient ubiquitous protein 1) (MaxLight 550)
MBS6276850-01 0.1 mL

AUP1, CT (AUP1, Ancient ubiquitous protein 1) (MaxLight 550)

Sign In for Pricing
View Details
AUP1, CT (AUP1, Ancient ubiquitous protein 1) (MaxLight 550)
MBS6276850-02 5x 0.1 mL

AUP1, CT (AUP1, Ancient ubiquitous protein 1) (MaxLight 550)

Sign In for Pricing
View Details