Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sus scrofa Platelet-derived growth factor subunit B

This Recombinant Sus scrofa Platelet-derived growth factor subunit B spans the amino acid sequence from region 21-240aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A8D1VN34

Expression Region

21-240aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDRADLDLNLTRSHSGGELESLSRGRRSLGSPTVAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVARPVTRSPGSSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETLGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER3 Antibody, FITC conjugated
CSB-PA878880LC01HU-01 50 µg

HOMER3 Antibody, FITC conjugated

Sign In for Pricing
View Details
HOMER3 Antibody, FITC conjugated
CSB-PA878880LC01HU-02 100 µg

HOMER3 Antibody, FITC conjugated

Sign In for Pricing
View Details
PECMV-Ptger4-m-FLAG
BZ15698 1 Vial

PECMV-Ptger4-m-FLAG

Sign In for Pricing
View Details
Human Protein Kinase C Epsilon (PKCe) ELISA Kit
orb1664092-01 48 Tests

Human Protein Kinase C Epsilon (PKCe) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Epsilon (PKCe) ELISA Kit
orb1664092-02 96 Tests

Human Protein Kinase C Epsilon (PKCe) ELISA Kit

Sign In for Pricing
View Details
CCL7 (MCP3, SCYA6, SCYA7, C-C motif Chemokine 7, Monocyte Chemoattractant Protein 3, Monocyte Chemotactic Protein 3, NC28, Small-inducible Cytokine A7, MGC138463, MGC138465) (Biotin)
124470-Biotin 100 µL

CCL7 (MCP3, SCYA6, SCYA7, C-C motif Chemokine 7, Monocyte Chemoattractant Protein 3, Monocyte Chemotactic Protein 3, NC28, Small-inducible Cytokine A7, MGC138463, MGC138465) (Biotin)

Sign In for Pricing
View Details