Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Japanese encephalitis virus Envelope protein (E), Partial

This Recombinant Japanese encephalitis virus Envelope protein (E), Partial spans the amino acid sequence from region 301-398aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A1XJE8

Expression Region

301-398aa

Tag

N-terminal 6xHis-Trx-tagged

Source

E.coli

Origin

Japanese encephalitis virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YGMCTEKFSFAKNPADTGHGTVVIELTYSGSDGPCKIPIVSVASLNDMTPVGRLVTVNPFVATSSSNSKVLVEMEPPFGDSYIVVGRGDKQINHHWHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Histidine Ammonia Lyase (HAL) ELISA
KBH21101 1x 96 Well

GENLISA™ Human Histidine Ammonia Lyase (HAL) ELISA

Sign In for Pricing
View Details
TRNAG32P Protein Vector (Human) (pPM-C-HA)
PV138908 500 ng

TRNAG32P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-Rb (Thr821) Recombinant Rabbit mAb
orb2327263-01 25 µL

Phospho-Rb (Thr821) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-Rb (Thr821) Recombinant Rabbit mAb
orb2327263-02 50 µL

Phospho-Rb (Thr821) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-Rb (Thr821) Recombinant Rabbit mAb
orb2327263-03 100 µL

Phospho-Rb (Thr821) Recombinant Rabbit mAb

Sign In for Pricing
View Details
COX10 Conjugated Antibody
C35579 100 µL

COX10 Conjugated Antibody

Sign In for Pricing
View Details