Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Japanese encephalitis virus Envelope protein (E), Partial

This Recombinant Japanese encephalitis virus Envelope protein (E), Partial spans the amino acid sequence from region 301-398aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A1XJE8

Expression Region

301-398aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Japanese encephalitis virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YGMCTEKFSFAKNPADTGHGTVVIELTYSGSDGPCKIPIVSVASLNDMTPVGRLVTVNPFVATSSSNSKVLVEMEPPFGDSYIVVGRGDKQINHHWHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-phospho-LYRIC (Ser568) antibody
SL18581R-01 50 µL

Rabbit Anti-phospho-LYRIC (Ser568) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-LYRIC (Ser568) antibody
SL18581R-02 100 µL

Rabbit Anti-phospho-LYRIC (Ser568) antibody

Sign In for Pricing
View Details
Human PSA (Total) Matched Antibody Pair Set [ABP-S-07316]
ABP-S-07316 5 Plates

Human PSA (Total) Matched Antibody Pair Set [ABP-S-07316]

Sign In for Pricing
View Details
TBX22 Protein Vector (Rat) (pPM-C-His)
PV310045 500 ng

TBX22 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Morpholine-d8 Hydrochloride
sc-477499 50 mg

Morpholine-d8 Hydrochloride

Sign In for Pricing
View Details
HAS1 Antibody
orb1264391 400 μl

HAS1 Antibody

Sign In for Pricing
View Details