Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial

This Recombinant Mouse Small conductance calcium-activated potassium channel protein 2 (Kcnn2), partial spans the amino acid sequence from region 1-376aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SK2; SKCa 2; SKCa2; KCa2.2

UniProt

P58390

Expression Region

1-376aa

Tag

C-terminal 6xHis-GFP-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

72.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPIVLVRPTNRTRRLDSTGAGMGPSSHQQQESPLPTITHCAGCTTAWSPCSFNSSDMETPLQFQRGFFPEQPPPPPRSSHLHCQQQQQSQDKPCAPFAPLPHPHHHPHLAHQQPGSGGSSPCLRCNSCASSGAPAAGAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCSSRRGSQLNVSELTPSSHASALRQQYAQQPASASQYHQCHSLQPATSPTGSLGSLGSGPPLSHHHHHPHPAHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGGGASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKSSKKKNQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFEB Antibody
E30AOC364 100 µL

TFEB Antibody

Sign In for Pricing
View Details
Conjugated MMP3 Rabbit mAb
C58636 100 µL

Conjugated MMP3 Rabbit mAb

Sign In for Pricing
View Details
Non-sterile Hydrophobic PTFE Syringe Filters, 0.22 (μm), 33 (mm), PP Prefilter, Orange, 50pcs/pk
11028518 50 PCS

Non-sterile Hydrophobic PTFE Syringe Filters, 0.22 (μm), 33 (mm), PP Prefilter, Orange, 50pcs/pk

Sign In for Pricing
View Details
Fibroblast Growth Factor Receptor 4 (FGFR4) Antibody
abx172425 1 mL

Fibroblast Growth Factor Receptor 4 (FGFR4) Antibody

Sign In for Pricing
View Details
Anti-V5 Antibody
MBS417516-01 0.1 mg

Anti-V5 Antibody

Sign In for Pricing
View Details
Anti-V5 Antibody
MBS417516-02 5x 0.1 mg

Anti-V5 Antibody

Sign In for Pricing
View Details