Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain acid soluble protein 1 (Basp1)

This Recombinant Mouse Brain acid soluble protein 1 (Basp1) spans the amino acid sequence from region 2-226aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

22 kDa neuronal tissue-enriched acidic protein; Neuronal axonal membrane protein NAP-22

UniProt

Q91XV3

Expression Region

2-226aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKDAADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQSVAVKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC4 (NM_013943) Human Tagged Lenti ORF Clone
RC201893L1 10 µg

CLIC4 (NM_013943) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal TROP-2 Antibody (TACSTD2/7349R) [Janelia Fluor 549]
NBP3-24007JF549 0.1 mL

Rabbit Monoclonal TROP-2 Antibody (TACSTD2/7349R) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Mouse CD1d Protein, C-His
bs-105974P-01 20 µg

Recombinant Mouse CD1d Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse CD1d Protein, C-His
bs-105974P-02 50 µg

Recombinant Mouse CD1d Protein, C-His

Sign In for Pricing
View Details
MCE 30mm*0.22μm syringe filter
ZL-MCE30-22 100 PCS/Box

MCE 30mm*0.22μm syringe filter

Sign In for Pricing
View Details
Human Kremen protein 1 (KREMEN1) ELISA Kit
YLA2537HU-01 48 Tests

Human Kremen protein 1 (KREMEN1) ELISA Kit

Sign In for Pricing
View Details