Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gasdermin-A (GSDMA)

This Recombinant Human Gasdermin-A (GSDMA) spans the amino acid sequence from region 1-445aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gasdermin-1; GSDMA-NT; GSDMA-CT

UniProt

Q96QA5

Expression Region

1-445aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allergen Sin a 1 Antibody
orb809166 2 mg

Allergen Sin a 1 Antibody

Sign In for Pricing
View Details
7- (deoxyadenosin-N (6) -yl) aristolactam I
orb1685089 5 mg

7- (deoxyadenosin-N (6) -yl) aristolactam I

Sign In for Pricing
View Details
HEV ORF3 Polyclonal Antibody, APC Conjugated
bs-0212R-APC 100 µL

HEV ORF3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Human C-C motif chemokine 16 protein (CCL16) (Active)
AP73286 20 µg

Recombinant Human C-C motif chemokine 16 protein (CCL16) (Active)

Sign In for Pricing
View Details
Mmp3 Rat shRNA Lentiviral Particle (Locus ID 171045)
TL712670V 500 µL Each

Mmp3 Rat shRNA Lentiviral Particle (Locus ID 171045)

Sign In for Pricing
View Details
Recombinant Human Arginase-2, GST, E.coli-200ug
QP5676-ec-200ug 200ug

Recombinant Human Arginase-2, GST, E.coli-200ug

Sign In for Pricing
View Details