Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 14-3-3 protein eta (Ywhah)

This Recombinant Mouse 14-3-3 protein eta (Ywhah) spans the amino acid sequence from region 2-246aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P68510

Expression Region

2-246aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human S100 Calcium Binding Protein A16
7-06289 5 µg

Recombinant Human S100 Calcium Binding Protein A16

Sign In for Pricing
View Details
Anti-GFAP Antibody Picoband®, Carrier-free
PA1239-carrier-free 100 µg/Vial

Anti-GFAP Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)
abx229295-01 20 Tests

Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)

Sign In for Pricing
View Details
Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)
abx229295-02 100 Tests

Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)

Sign In for Pricing
View Details
Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)
abx229295-03 200 Tests

Mast/Stem Cell Growth Factor Receptor Kit (KIT) Antibody (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal VWCE Antibody
NBP2-30467-25ul 25 µL

Rabbit Polyclonal VWCE Antibody

Sign In for Pricing
View Details