Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SPARC-related modular calcium-binding protein 2 (SMOC2)

This Recombinant Human SPARC-related modular calcium-binding protein 2 (SMOC2) spans the amino acid sequence from region 22-446aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted modular calcium-binding protein 2; SMOC-2; Smooth muscle-associated protein 2; SMAP-2

UniProt

Q9H3U7

Expression Region

22-446aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGHAESTSNRQPRKQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LHX2 Knockout HEK293T cell line
GTR15411137 1 Vial

Human LHX2 Knockout HEK293T cell line

Sign In for Pricing
View Details
CSGALNACT1 (CHGN, GALNACT1, Chondroitin Sulfate N-acetylgalactosaminyltransferase 1, CsGalNAcT-1, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, FLJ11264, FLJ13760, Beta4GalNAcT, UNQ656/PRO1287) (APC)
125396-APC 100 µL

CSGALNACT1 (CHGN, GALNACT1, Chondroitin Sulfate N-acetylgalactosaminyltransferase 1, CsGalNAcT-1, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, FLJ11264, FLJ13760, Beta4GalNAcT, UNQ656/PRO1287) (APC)

Sign In for Pricing
View Details
3- (tert-Butoxycarbonyl) -3-azabicyclo[4.1.0]heptane-1-carboxylic acid
OR88723 1 Each

3- (tert-Butoxycarbonyl) -3-azabicyclo[4.1.0]heptane-1-carboxylic acid

Sign In for Pricing
View Details
CBMR 0083
7890/50 50 mg

CBMR 0083

Sign In for Pricing
View Details
Lentiviral human HIF1AN shRNA (UAS) - Lentiviral human HIF1AN shRNA (UAS, GFP) (100)
GTR15111549 1 Vial

Lentiviral human HIF1AN shRNA (UAS) - Lentiviral human HIF1AN shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Urease related protein C (UreC) ELISA Kit
AE63106HU-01 48 Tests

Human Urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details