Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), Partial

This Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), Partial spans the amino acid sequence from region 266-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pre-GP-C; SSP; GP1; GP2

UniProt

P09991

Expression Region

266-498aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pskh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37933116 3x 1.0 µg

Pskh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)
MBS1083568-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)
MBS1083568-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)
MBS1083568-03 0.02 mg (Yeast)

Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)
MBS1083568-04 0.1 mg (Yeast)

Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)
MBS1083568-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O9:H4 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details