Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD209 antigen-like protein B (Cd209b), partial

This Recombinant Mouse CD209 antigen-like protein B (Cd209b), partial spans the amino acid sequence from region 74-325aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DC-SIGN-related protein 1; DC-SIGNR1; OtB7; CD antigen CD209

UniProt

Q8CJ91

Expression Region

74-325aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6,7,8,9-Tetrahydro-5,9-methano-5H-pyrido[3,4-d]azepine Dihydrochloride
439003-01 10 mg

6,7,8,9-Tetrahydro-5,9-methano-5H-pyrido[3,4-d]azepine Dihydrochloride

Sign In for Pricing
View Details
6,7,8,9-Tetrahydro-5,9-methano-5H-pyrido[3,4-d]azepine Dihydrochloride
439003-02 100 mg

6,7,8,9-Tetrahydro-5,9-methano-5H-pyrido[3,4-d]azepine Dihydrochloride

Sign In for Pricing
View Details
N- (acid-PEG3) -N-bis (PEG3-azide)
HY-140520-01 50 mg

N- (acid-PEG3) -N-bis (PEG3-azide)

Sign In for Pricing
View Details
N- (acid-PEG3) -N-bis (PEG3-azide)
HY-140520-02 100 mg

N- (acid-PEG3) -N-bis (PEG3-azide)

Sign In for Pricing
View Details
N- (acid-PEG3) -N-bis (PEG3-azide)
HY-140520-03 250 mg

N- (acid-PEG3) -N-bis (PEG3-azide)

Sign In for Pricing
View Details
GTF2E2 Antibody - middle region : Biotin (ARP38103_P050-Biotin)
ARP38103_P050-Biotin 100 µL

GTF2E2 Antibody - middle region : Biotin (ARP38103_P050-Biotin)

Sign In for Pricing
View Details