Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Fibroblast growth factor 2 (FGF2)

This Recombinant Sheep Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 10-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P20003

Expression Region

10-155aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S,4aS,8aS)-Decahydro-N-t-butyl-3-isoquinolinecarboxamide
TRC-D211100-250MG 250 mg

(3S,4aS,8aS)-Decahydro-N-t-butyl-3-isoquinolinecarboxamide

Sign In for Pricing
View Details
GluR2 (Ab-880) Antibody
8B7096-AAT 50 µg

GluR2 (Ab-880) Antibody

Sign In for Pricing
View Details
Human GFM2 activation kit by CRISPRa
GA113530 1 Kit

Human GFM2 activation kit by CRISPRa

Sign In for Pricing
View Details
2-((Thiophene-2-carbonyl)thio)propanoic-3,3,3-D3 Acid
TRC-T814662-25MG 25 mg

2-((Thiophene-2-carbonyl)thio)propanoic-3,3,3-D3 Acid

Sign In for Pricing
View Details
Lumichrome
TRC-L473850-1G 1 g

Lumichrome

Sign In for Pricing
View Details
Mouse Cyp11a1 activation kit by CRISPRa
GA200967 1 Kit

Mouse Cyp11a1 activation kit by CRISPRa

Sign In for Pricing
View Details