Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pantoea stewartii subsp. stewartii Transcriptional activator protein esaR (esaR)

This Recombinant Pantoea stewartii subsp. stewartii Transcriptional activator protein esaR (esaR) spans the amino acid sequence from region 1-249aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P54293

Expression Region

1-249aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pantoea stewartii subsp. stewartii (Erwinia stewartii)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFSFFLENQTITDTLQTYIQRKLSPLGSPDYAYTVVSKKNPSNVLIISSYPDEWIRLYRANNFQLTDPVILTAFKRTSPFAWDENITLMSDLRFTKIFSLSKQYNIVNGFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLIDFNEQMYRLAGTEGERAPALNQSADKTIFSSRENEVLYWASMGKTYAEIAAITGISVSTVKFHIKNVVVKLGVSNARQAIRLGVELDLIRPAASAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gstm1 sgRNA CRISPR Lentivector set (Mouse)
K3426101 3x 1.0 µg

Gstm1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Cyclin M2 Polyclonal Antibody, APC Conjugated
bs-6912R-APC 100 µL

Cyclin M2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
hsa-miR-6865-3p miRNA Antagomir
MBS8318336-01 10 nmol

hsa-miR-6865-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6865-3p miRNA Antagomir
MBS8318336-02 20 nmol

hsa-miR-6865-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6865-3p miRNA Antagomir
MBS8318336-03 5x 20 nmol

hsa-miR-6865-3p miRNA Antagomir

Sign In for Pricing
View Details
Thyrotropin Receptor (TSHR) Canine ELISA Kit
H6123 96 Tests

Thyrotropin Receptor (TSHR) Canine ELISA Kit

Sign In for Pricing
View Details