Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-33A (RAB33A)

This Recombinant Human Ras-related protein Rab-33A (RAB33A) spans the amino acid sequence from region 1-237aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small GTP-binding protein S10

UniProt

Q14088

Expression Region

1-237aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inavolisib (GDC-0077)
C13576-25mg 25 mg

Inavolisib (GDC-0077)

Sign In for Pricing
View Details
NX-13
E4755-5mg 5 mg

NX-13

Sign In for Pricing
View Details
ZFP51 (m) -PR
sc-155561-PR 10 µM - 20 µL

ZFP51 (m) -PR

Sign In for Pricing
View Details
Mouse Ccdc158 qPCR Primer Pair
QM70754S 200 Tests

Mouse Ccdc158 qPCR Primer Pair

Sign In for Pricing
View Details
VU0238441
S0782-25mg 25 mg

VU0238441

Sign In for Pricing
View Details
BAG1 discontinued
386328 200 µL

BAG1 discontinued

Sign In for Pricing
View Details