Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein C15/B21

This Recombinant Vaccinia virus Protein C15/B21 spans the amino acid sequence from region 1-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P21099

Expression Region

1-91aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLESFIITTFNNNSSTNIDNMCHLYVKVCPSSLLFRLFVECCDINKLVEGTTPLHCYLMNEGFESSVLKNLLKEYVMNTFNVHDIHYTNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-
F-3101-2 2 mg

FITC Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-

Sign In for Pricing
View Details
HCoV-229E S1 protein, His Tag
SIN-V52H4-100ug 100 µg

HCoV-229E S1 protein, His Tag

Sign In for Pricing
View Details
DNASE1L2 (NM_001374) Human Over-expression Lysate
LC419981 20 µg

DNASE1L2 (NM_001374) Human Over-expression Lysate

Sign In for Pricing
View Details
ABC3735 Goat Polyclonal Antibody
TA396683S 25 µL

ABC3735 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Hexahelicene
TRC-H296850-5MG 5 mg

Hexahelicene

Sign In for Pricing
View Details
Txnip Mouse Gene Knockout Kit (CRISPR)
KN318517 1 Kit

Txnip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details