Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein C15/B21

This Recombinant Vaccinia virus Protein C15/B21 spans the amino acid sequence from region 1-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P21099

Expression Region

1-91aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLESFIITTFNNNSSTNIDNMCHLYVKVCPSSLLFRLFVECCDINKLVEGTTPLHCYLMNEGFESSVLKNLLKEYVMNTFNVHDIHYTNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Helicobacter pylori (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470374-100 1x 100 µL

Helicobacter pylori (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn1r57 Mouse Gene Knockout Kit (CRISPR)
KN519071 1 Kit

Vmn1r57 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UPP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11F11]
TA812318BM 100 µL

UPP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11F11]

Sign In for Pricing
View Details
Bim (BCL2L11) Rabbit Polyclonal Antibody
TA374008 100 µL

Bim (BCL2L11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MyoD1 (MYD712), CF488A conjugate, 0.1mg/mL
BNC880712-500 1x 500 µL

MyoD1 (MYD712), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Smooth Muscle Myosin heavy chain 11 Monoclonal Antibody
AN301659L-01 50 µL

Recombinant Smooth Muscle Myosin heavy chain 11 Monoclonal Antibody

Sign In for Pricing
View Details