Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 5 (GDF5)

This Recombinant Human Growth/differentiation factor 5 (GDF5) spans the amino acid sequence from region 382-501aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-5; Bone morphogenetic protein 14; BMP-14; Cartilage-derived morphogenetic protein 1; CDMP-1; Lipopolysaccharide-associated protein 4; LAP-4; LPS-associated protein 4; Radotermin

UniProt

P43026

Expression Region

382-501aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-01 0.5 mg (E-Coli)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-02 0.05 mg (Baculovirus)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-03 0.5 mg (Yeast)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-04 0.05 mg (Mammalian-Cell)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-05 1 mg (E-Coli)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details
Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial
MBS1363831-06 0.1 mg (Baculovirus)

Recombinant Macaca nemestrina Tumor necrosis factor receptor superfamily member 6 (FAS), partial

Sign In for Pricing
View Details