Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), Partial
This Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), Partial spans the amino acid sequence from region 95-195aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
HASC; Caspase recruitment domain-containing protein 5; PYD and CARD domain-containing protein; Target of methylation-induced silencing 1
UniProt
Q9ULZ3
Expression Region
95-195aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx517123 96 Well
Mouse Mannose Binding Lectin 2 (Protein C) (MBL2) ELISA Kit
Sign In for Pricing
View Details