Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxiredoxin-6 (Prdx6)

This Recombinant Mouse Peroxiredoxin-6 (Prdx6) spans the amino acid sequence from region 2-224aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-Cys peroxiredoxin;1-Cys PRX; Acidic calcium-independent phospholipase A2; aiPLA2; EC 3.1.1.4; Antioxidant protein 2; Glutathione-dependent peroxiredoxin; Lysophosphatidylcholine acyltransferase 5; LPC acyltransferase 5; LPCAT-5; Lyso-PC acyltransferase 5; EC 2.3.1.23; Non-selenium glutathione peroxidase; NSGPx

UniProt

O08709

Expression Region

2-224aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5a discontinued
298933 100 µL

STAT5a discontinued

Sign In for Pricing
View Details
Lentiviral mouse Slfn5 shRNA (UAS) - Lentiviral mouse Slfn5 shRNA (UAS, GFP) (100)
GTR15285981 1 Vial

Lentiviral mouse Slfn5 shRNA (UAS) - Lentiviral mouse Slfn5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
D-dimer (15C18), mAb, Mouse
V01403-100 100 mg

D-dimer (15C18), mAb, Mouse

Sign In for Pricing
View Details
Exportin 1, CT (XPO1, Chromosome Region Maintenance 1 Protein Homolog, CRM1, DKFZp686B1823, emb, Exp1, Exportin-1) (MaxLight 750) discontinued
E9009-31D-ML750 100 µL

Exportin 1, CT (XPO1, Chromosome Region Maintenance 1 Protein Homolog, CRM1, DKFZp686B1823, emb, Exp1, Exportin-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
IDH3A Rabbit Polyclonal Antibody (Biotin)
orb2122522 100 µL

IDH3A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PLV2-TRE3GS-Fluc-MYB (human) -6xHis-TetOne-Hyg
BZ58952 1 Vial

PLV2-TRE3GS-Fluc-MYB (human) -6xHis-TetOne-Hyg

Sign In for Pricing
View Details