Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis CD276 molecule (CD276), partial (Active)

This Recombinant Macaca fascicularis CD276 molecule (CD276), partial (Active) spans the amino acid sequence from region 29-465aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A7N9CYV2

Expression Region

29-465aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody. The EC50 is 4.299-5.373 ng/mL.

Form

Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delicious Peptide
E-PP-1033-01 10 mg

Delicious Peptide

Sign In for Pricing
View Details
Delicious Peptide
E-PP-1033-02 100 mg

Delicious Peptide

Sign In for Pricing
View Details
Delicious Peptide
E-PP-1033-03 5 mg

Delicious Peptide

Sign In for Pricing
View Details
Anti-CD279/PDCD1/PD1 (LVGN3616) Biosimilar (Monoclonal, IgG)
A136586 100 µL

Anti-CD279/PDCD1/PD1 (LVGN3616) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
CD298 Polyclonal Antibody
orb1414386 100 µL

CD298 Polyclonal Antibody

Sign In for Pricing
View Details
PCMV-PKM (human) -3xFLAG-Neo
BZ20313 1 Vial

PCMV-PKM (human) -3xFLAG-Neo

Sign In for Pricing
View Details