Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Folate receptor alpha (FOLR1), partial (Active)

This Recombinant Macaca fascicularis Folate receptor alpha (FOLR1), partial (Active) spans the amino acid sequence from region 25-233aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2K5U044

Expression Region

25-233aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody. The EC50 is 2.900-3.544 ng/mL.

Form

Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
CALB1 Antibody
KC-3808-01 50 μL

CALB1 Antibody

Sign In for Pricing
View Details
CALB1 Antibody
KC-3808-02 100 µL

CALB1 Antibody

Sign In for Pricing
View Details
CALB1 Antibody
KC-3808-03 1 mL

CALB1 Antibody

Sign In for Pricing
View Details