Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

This Recombinant Human Lymphocyte antigen 6E (LY6E) spans the amino acid sequence from region 21-101aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein (RIG-E) ; Stem cell antigen 2 (SCA-2) ; Thymic shared antigen 1 (TSA-1) ; LY6E; 9804, RIGE, SCA2, TSA1

UniProt

Q16553

Expression Region

21-101aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody. The EC50 is 2.483-3.282 ng/mL.

Form

Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS557620 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
SULT1C2 CRISPR/Cas9 KO Plasmid (h)
sc-406300 20 µg

SULT1C2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Keratin 39 Polyclonal Antibody, HRP Conjugated
bs-16950R-HRP 100 µL

Keratin 39 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anti-Rb Rabbit Monoclonal Antibody
MBS179051-01 0.03 mL

Anti-Rb Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Rb Rabbit Monoclonal Antibody
MBS179051-02 0.1 mL

Anti-Rb Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Rb Rabbit Monoclonal Antibody
MBS179051-03 5x 0.1 mL

Anti-Rb Rabbit Monoclonal Antibody

Sign In for Pricing
View Details