Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial

This Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial spans the amino acid sequence from region 30-233aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibronectin type III domain containing 6; FNDC6; IL-20 receptor subunit beta; IL-20R-beta; IL-20RB; IL-20R2; DIRS1

UniProt

Q6UXL0

Expression Region

30-233aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (Ser428) polyclonal antibody
AP0166-01 50 µL

LKB1 (Ser428) polyclonal antibody

Sign In for Pricing
View Details
LKB1 (Ser428) polyclonal antibody
AP0166-02 100 µL

LKB1 (Ser428) polyclonal antibody

Sign In for Pricing
View Details
Hexadecyl prop-2-enoate
BUP17201-01 10 mg

Hexadecyl prop-2-enoate

Sign In for Pricing
View Details
Hexadecyl prop-2-enoate
BUP17201-02 25 mg

Hexadecyl prop-2-enoate

Sign In for Pricing
View Details
Hexadecyl prop-2-enoate
BUP17201-03 50 mg

Hexadecyl prop-2-enoate

Sign In for Pricing
View Details
Hexadecyl prop-2-enoate
BUP17201-04 100 mg

Hexadecyl prop-2-enoate

Sign In for Pricing
View Details