Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128), partial
This Recombinant Human E3 ubiquitin-protein ligase RNF128 (RNF128), partial spans the amino acid sequence from region 75-183aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Gene related to anergy in lymphocytes protein; GRAIL; RING finger protein 128; RING-type E3 ubiquitin transferase RNF128
UniProt
Q8TEB7
Expression Region
75-183aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Molecular Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033933-ML405 100 µL
CLC, CT (CLC, Eosinophil lysophospholipase, Charcot-Leyden crystal protein, Galectin-10, Lysolecithin acylhydrolase) (MaxLight 405) discontinued
Sign In for Pricing
View Details GTR15234291 1 Vial
Lentiviral mouse Mapre2 shRNA (UAS) - Lentiviral mouse Mapre2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
MBS2609251-01 48 Well
Bovine High Density Lipoprotein (HDL) ELISA Kit
Sign In for Pricing
View Details