Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1, partial

This Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1, partial spans the amino acid sequence from region 32-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Imperatoxin I; IpTx1; IpTxi; Imperatoxin inhibitor; Imperatoxin I large subunit; Imperatoxin I small subunit

UniProt

P59888

Expression Region

32-135aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Pandinus imperator (Emperor scorpion)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: left
CR561423 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Human Bestrophin 3 (BEST3) activation kit by CRISPRa
GA115498 1 Kit

Human Bestrophin 3 (BEST3) activation kit by CRISPRa

Sign In for Pricing
View Details
Wtip Mouse Gene Knockout Kit (CRISPR)
KN519474 1 Kit

Wtip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELK3 antibody
FNab10053 100 µg

ELK3 antibody

Sign In for Pricing
View Details
GSTA4 (NM_001512) Human Over-expression Lysate
LC400591 20 µg

GSTA4 (NM_001512) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL
BNC470280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details