Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukemia inhibitory factor (Lif)

This Recombinant Mouse Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 1-203aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Differentiation-stimulating factor (D factor)

UniProt

P09056

Expression Region

24-203aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Taste receptor type 2 member 50 (TAS2R50), partial
MBS7112463 Inquire

Recombinant Human Taste receptor type 2 member 50 (TAS2R50), partial

Sign In for Pricing
View Details
Lentiviral human PCDH17 shRNA (UAS) - Lentiviral human PCDH17 shRNA (UAS) (100)
GTR15101922 1 Vial

Lentiviral human PCDH17 shRNA (UAS) - Lentiviral human PCDH17 shRNA (UAS) (100)

Sign In for Pricing
View Details
Casq2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3999904 1.0 µg DNA

Casq2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
C2 (Complement C2, C3/C5 Convertase, CO2, DKFZp779M0311) (MaxLight 650)
MBS6399764-01 0.1 mL

C2 (Complement C2, C3/C5 Convertase, CO2, DKFZp779M0311) (MaxLight 650)

Sign In for Pricing
View Details
C2 (Complement C2, C3/C5 Convertase, CO2, DKFZp779M0311) (MaxLight 650)
MBS6399764-02 5x 0.1 mL

C2 (Complement C2, C3/C5 Convertase, CO2, DKFZp779M0311) (MaxLight 650)

Sign In for Pricing
View Details
1-N-Butyl-1-phenylhydrazine
OR921493 5 g

1-N-Butyl-1-phenylhydrazine

Sign In for Pricing
View Details