Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukemia inhibitory factor (Lif)

This Recombinant Rat Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 1-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Cholinergic neuronal differentiation factor

UniProt

P17777

Expression Region

23-202aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit
MBS7252260-01 48 Well

Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit
MBS7252260-02 96 Well

Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit
MBS7252260-03 5x 96 Well

Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit
MBS7252260-04 10x 96 Well

Sheep Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Neuregulin-1/NRG1 Antibody (NRG1/2752) [Alexa Fluor 488]
NBP2-79847AF488 0.1 mL

Mouse Monoclonal Neuregulin-1/NRG1 Antibody (NRG1/2752) [Alexa Fluor 488]

Sign In for Pricing
View Details
RAET1L Human shRNA Plasmid Kit (Locus ID 154064)
TL307456 1 Kit

RAET1L Human shRNA Plasmid Kit (Locus ID 154064)

Sign In for Pricing
View Details