Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD276 antigen (Cd276), partial

This Recombinant Mouse CD276 antigen (Cd276), partial spans the amino acid sequence from region 1-244aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B7 homolog 3 (B7-H3) ; Costimulatory molecule

UniProt

Q8VE98

Expression Region

1-244aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr26 (NM_146783) Mouse Tagged Lenti ORF Clone
MR213769L4 10 µg

Olfr26 (NM_146783) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-MDM2 (Thr218) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5470R-BF594 100 µL

Phospho-MDM2 (Thr218) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Translin (TSN) Mouse Monoclonal Antibody [Clone ID: OTI8F9]
TA809194S 30 µL

Translin (TSN) Mouse Monoclonal Antibody [Clone ID: OTI8F9]

Sign In for Pricing
View Details
CALB1 ELISA Kit (Mouse) : 96 Wells (OKEH00768)
OKEH00768 96 Well

CALB1 ELISA Kit (Mouse) : 96 Wells (OKEH00768)

Sign In for Pricing
View Details
Rat Ovarian Microvascular Endothelial Cells
ABC-TC4188 1 Vial

Rat Ovarian Microvascular Endothelial Cells

Sign In for Pricing
View Details
Rabbit Polyclonal SLITRK1 Antibody [DyLight 594]
NBP1-77319DL594 0.1 mL

Rabbit Polyclonal SLITRK1 Antibody [DyLight 594]

Sign In for Pricing
View Details