Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement factor I (CFI)

This Recombinant Human Complement factor I (CFI) spans the amino acid sequence from region 19-583aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C3B/C4B inactivator

UniProt

P05156

Expression Region

19-583aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CX3CR1
GT13552 25 Tests

PE anti-human CX3CR1

Sign In for Pricing
View Details
Mouse PCNA-associated factor ELISA Kit
MBS9428679-01 96 Tests

Mouse PCNA-associated factor ELISA Kit

Sign In for Pricing
View Details
Mouse PCNA-associated factor ELISA Kit
MBS9428679-02 5x 96 Tests

Mouse PCNA-associated factor ELISA Kit

Sign In for Pricing
View Details
Goose Adenylate Cyclase 7 (ADCY7) ELISA Kit
MBS9368756 Inquire

Goose Adenylate Cyclase 7 (ADCY7) ELISA Kit

Sign In for Pricing
View Details
STXBP2 Rabbit Polyclonal Antibody (Fluoro488)
orb3075604 100 µg

STXBP2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Rabbit anti-human Dynein light chain roadblock-type 1 polyclonal Antibody(DYNLRB1), Biotin conjugated
MBS1498487-01 0.05 mg

Rabbit anti-human Dynein light chain roadblock-type 1 polyclonal Antibody(DYNLRB1), Biotin conjugated

Sign In for Pricing
View Details