Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human metapneumovirus Matrix protein (M)

This Recombinant Human metapneumovirus Matrix protein (M) spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6WB99

Expression Region

1-254aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Human metapneumovirus (strain CAN97-83) (HMPV)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin B2 (Riboflavin) 13C4 ,15N2
TRC-V676023-0.5MG 0.5 mg

Vitamin B2 (Riboflavin) 13C4 ,15N2

Sign In for Pricing
View Details
BCOR Mouse Monoclonal Antibody [Clone ID: OTI4F6]
CF807724 100 µg

BCOR Mouse Monoclonal Antibody [Clone ID: OTI4F6]

Sign In for Pricing
View Details
Cletoquine-d4
TRC-C573507-2.5MG 2.5 mg

Cletoquine-d4

Sign In for Pricing
View Details
Cyclosporin B
TRC-C988903-25MG 25 mg

Cyclosporin B

Sign In for Pricing
View Details
BCL10 (122-168) Mouse Monoclonal Antibody [Clone ID: BL10/411]
AM32814PU-T 20 µg

BCL10 (122-168) Mouse Monoclonal Antibody [Clone ID: BL10/411]

Sign In for Pricing
View Details
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), Biotin conjugate, 0.1mg/mL
BNCB3351-500 1x 500 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details