Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (I) chain (COL1A1), partial

This Recombinant Human Collagen alpha-1 (I) chain (COL1A1), partial spans the amino acid sequence from region 334-389aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-1 type I collagen

UniProt

P02452

Expression Region

334-389aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1G3 CRISPR Knock Out 293T Cell Line (Human)
12808141 1x 10^6 Cells / 1.0 mL

ATP6V1G3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Lentiviral human PACS2 shRNA (UAS) - Lentiviral human PACS2 shRNA (UAS) (100)
GTR15089130 1 Vial

Lentiviral human PACS2 shRNA (UAS) - Lentiviral human PACS2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Gdap2 shRNA (UAS) - Lentiviral mouse Gdap2 shRNA (UAS, GFP) (100)
GTR15212325 1 Vial

Lentiviral mouse Gdap2 shRNA (UAS) - Lentiviral mouse Gdap2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ACOX3 Antibody
orb252377 100 µL

ACOX3 Antibody

Sign In for Pricing
View Details
Val-Cit-PAB-MMAE
MBS5771726 Inquire

Val-Cit-PAB-MMAE

Sign In for Pricing
View Details
FITC*Polyclonal   Rabbit Anti-Guinea Pig IgG
C030625-1ml 1ml

FITC*Polyclonal Rabbit Anti-Guinea Pig IgG

Sign In for Pricing
View Details