Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

This Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial spans the amino acid sequence from region 1-262aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin 2 receptor, gamma

UniProt

Q68FU6

Expression Region

1-262aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPSLFALEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 11 (IL11) Antibody
abx177082-01 200 µg

Interleukin 11 (IL11) Antibody

Sign In for Pricing
View Details
Interleukin 11 (IL11) Antibody
abx177082-02 1 mg

Interleukin 11 (IL11) Antibody

Sign In for Pricing
View Details
Quick Step Mouse Heat Shock Protein 70, Hsp-70 ELISA Kit
QS0256Mo-01 48 Tests

Quick Step Mouse Heat Shock Protein 70, Hsp-70 ELISA Kit

Sign In for Pricing
View Details
Quick Step Mouse Heat Shock Protein 70, Hsp-70 ELISA Kit
QS0256Mo-02 96 Tests

Quick Step Mouse Heat Shock Protein 70, Hsp-70 ELISA Kit

Sign In for Pricing
View Details
TMEM165 Rabbit pAb
A17183-01 100 μL

TMEM165 Rabbit pAb

Sign In for Pricing
View Details
TMEM165 Rabbit pAb
A17183-02 20 µL

TMEM165 Rabbit pAb

Sign In for Pricing
View Details