Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial

This Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial spans the amino acid sequence from region 2199-2304aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-II spectrin; Embryonic liver fodrin; Fodrin beta chain

UniProt

Q62261

Expression Region

2199-2304aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASF2 Conjugated Antibody
MBS9445862-01 0.1 mL (Biotin)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details
WASF2 Conjugated Antibody
MBS9445862-02 0.1 mL (AF350)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details
WASF2 Conjugated Antibody
MBS9445862-03 0.1 mL (AF405)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details
WASF2 Conjugated Antibody
MBS9445862-04 0.1 mL (AF488)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details
WASF2 Conjugated Antibody
MBS9445862-05 0.1 mL (AF555)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details
WASF2 Conjugated Antibody
MBS9445862-06 0.1 mL (AF594)

WASF2 Conjugated Antibody

Sign In for Pricing
View Details