Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Barrier-to-autointegration factor (baf)

This Recombinant Drosophila melanogaster Barrier-to-autointegration factor (baf) spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9VLU0

Expression Region

1-90aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Drosophila melanogaster (Fruit fly)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF808276 100 µg

p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

Sign In for Pricing
View Details
YIPF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2654605 3x 1.0 µg

YIPF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PPP1R3A Adenovirus (Mouse)
37453054 1.0 mL

PPP1R3A Adenovirus (Mouse)

Sign In for Pricing
View Details
Human sCD40L ELISA Kit
E28L0003 96 Tests

Human sCD40L ELISA Kit

Sign In for Pricing
View Details
VPS35 Human Gene Knockout Kit (CRISPR)
KN210597BN 1 Kit

VPS35 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
[KO Validated] AKR1A1 Rabbit pAb
MBS9144479-01 0.02 mL

[KO Validated] AKR1A1 Rabbit pAb

Sign In for Pricing
View Details