Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

This Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial spans the amino acid sequence from region 35-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q86UX2

Expression Region

35-161aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF1A Protein Vector (Mouse) (pPM-C-His)
PV189273 500 ng

HNF1A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
APOBEC4 shRNA Plasmid (h)
sc-88795-SH 20 µg

APOBEC4 shRNA Plasmid (h)

Sign In for Pricing
View Details
HADHB
enz-845 5µg

HADHB

Sign In for Pricing
View Details
1700001C02Rik AAV siRNA Pooled Vector
10110164 1.0 µg

1700001C02Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
undefined - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
TL317409 5 µg/Vial

undefined - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Sign In for Pricing
View Details
ALPS1 peptide from ArfGAP1
orb3142379-01 50 mg

ALPS1 peptide from ArfGAP1

Sign In for Pricing
View Details