Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E7 (E7)

This Recombinant Human papillomavirus type 16 Protein E7 (E7) spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03129

Expression Region

1-98aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Human papillomavirus type 16

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GLYAT Knockout HEK293T cell line
GTR15403364 1 Vial

Human GLYAT Knockout HEK293T cell line

Sign In for Pricing
View Details
HMGCR Antibody
14-912 100 µL

HMGCR Antibody

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF740 conjugate, 0.1mg/mL
BNC742362-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSFL1C Antibody
orb2674401-01 50 µL

NSFL1C Antibody

Sign In for Pricing
View Details
NSFL1C Antibody
orb2674401-02 100 µL

NSFL1C Antibody

Sign In for Pricing
View Details
NSFL1C Antibody
orb2674401-03 200 µL

NSFL1C Antibody

Sign In for Pricing
View Details