Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E7 (E7)

This Recombinant Human papillomavirus type 16 Protein E7 (E7) spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03129

Expression Region

1-98aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Human papillomavirus type 16

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-Off-mmu-miR-7036a-3p Virus
mm6616 1.0 mL

AdmiRa-Off-mmu-miR-7036a-3p Virus

Sign In for Pricing
View Details
ATPAF2 discontinued
533392-01 30ul

ATPAF2 discontinued

Sign In for Pricing
View Details
ATPAF2 discontinued
533392-02 100 µL

ATPAF2 discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human JAK1 Polyclonal Antibody
PA83015HU-01 50 µg

Rabbit Anti-Human JAK1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human JAK1 Polyclonal Antibody
PA83015HU-02 100 µg

Rabbit Anti-Human JAK1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human JAK1 Polyclonal Antibody
PA83015HU-03 500 µg

Rabbit Anti-Human JAK1 Polyclonal Antibody

Sign In for Pricing
View Details