Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial (Active)

Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor (PTH/PTHr receptor) ; Parathyroid hormone 1 receptor (PTH1 receptor) ; Pth1r; Pthr, Pthr1

Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 μg/mL can bind Anti-PTH1R recombinant antibody. The EC50 is 0.7384-1.203 ng/mL.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLG