Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial

This Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial spans the amino acid sequence from region 31-444aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PCDH-gamma-B3

UniProt

Q9Y5G1

Expression Region

31-444aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVAEKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLASESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNPPLSSSKTITLHILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Adenoid
CS709199 5x 5 µm

Tissue FFPE Sections, Adenoid

Sign In for Pricing
View Details
ASS1P11 Human qPCR Primer Pair (XM_294215)
HP221581 200 Reactions

ASS1P11 Human qPCR Primer Pair (XM_294215)

Sign In for Pricing
View Details
TBL1Y (NM_134259) Human Recombinant Protein
TP312240L 1 mg

TBL1Y (NM_134259) Human Recombinant Protein

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF740 conjugate, 0.1mg/mL
BNC742713-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HighRanger 1kb DNA Ladder
11900 100 Loads

HighRanger 1kb DNA Ladder

Sign In for Pricing
View Details
Mouse Fibulin 7 (FBLN7) ELISA Kit
RDR-FBLN7-Mu-01 96 Tests

Mouse Fibulin 7 (FBLN7) ELISA Kit

Sign In for Pricing
View Details