Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial

This Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial spans the amino acid sequence from region 31-444aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PCDH-gamma-B3

UniProt

Q9Y5G1

Expression Region

31-444aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVAEKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLASESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNPPLSSSKTITLHILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Panduratin A (>80%)
TRC-P178750-10MG 10 mg

(±)-Panduratin A (>80%)

Sign In for Pricing
View Details
Cbl c (CBLC) (C-term) Rabbit Polyclonal Antibody
AP11262PU-N 400 µL

Cbl c (CBLC) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TMEM18 activation kit by CRISPRa
GA115091 1 Kit

Human TMEM18 activation kit by CRISPRa

Sign In for Pricing
View Details
Basic Red 51 (Technical Grade)
TRC-B118740-250MG 250 mg

Basic Red 51 (Technical Grade)

Sign In for Pricing
View Details
Recombinant Mouse JAM-A/F11R Protein (Fc Tag)
PKSM040670 100 µg

Recombinant Mouse JAM-A/F11R Protein (Fc Tag)

Sign In for Pricing
View Details
WNT1 (C-term) Rabbit Polyclonal Antibody
AP17833PU-N 400 µL

WNT1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details