Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6)

This Recombinant Human Interleukin-6 (IL6) spans the amino acid sequence from region 30-212aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 ; BSF-2; CTL differentiation factor ; CDFHybridoma growth factorInterferon beta-2 ; IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Nucleocapsid Protein Antibody
K06251M02G06C-01 50 ug

SARS-CoV-2 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Antibody
K06251M02G06C-02 100 ug

SARS-CoV-2 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein Antibody
K06251M02G06C-03 1 mg

SARS-CoV-2 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
HS3ST3A1 Antibody
orb2679232-01 50 µL

HS3ST3A1 Antibody

Sign In for Pricing
View Details
HS3ST3A1 Antibody
orb2679232-02 100 µL

HS3ST3A1 Antibody

Sign In for Pricing
View Details
HS3ST3A1 Antibody
orb2679232-03 200 µL

HS3ST3A1 Antibody

Sign In for Pricing
View Details