Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 9 (GDF9)

This Recombinant Human Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 320-454aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

O60383

Expression Region

320-454aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UK114 rabbit pAb
ES18981-01 50 µL

UK114 rabbit pAb

Sign In for Pricing
View Details
UK114 rabbit pAb
ES18981-02 100 µL

UK114 rabbit pAb

Sign In for Pricing
View Details
YKT6 (NM_006555) Human Over-expression Lysate
LY416570 100 µg

YKT6 (NM_006555) Human Over-expression Lysate

Sign In for Pricing
View Details
TFEB Antibody [G16A13]
C21675-100uL 100 µL

TFEB Antibody [G16A13]

Sign In for Pricing
View Details
Human Troponin T, Cardiac Muscle (TNNT2) Protein
abx060225 100 µg

Human Troponin T, Cardiac Muscle (TNNT2) Protein

Sign In for Pricing
View Details
Human Putative E3 ubiquitin-protein ligase makorin-4 (MKRN4P) ELISA Kit
abx533157 96 Tests

Human Putative E3 ubiquitin-protein ligase makorin-4 (MKRN4P) ELISA Kit

Sign In for Pricing
View Details