Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype G Protein Vpr (vpr)

This Recombinant Human immunodeficiency virus type 1 group M subtype G Protein Vpr (vpr) spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

R ORF protein; Viral protein R

UniProt

O89942

Expression Region

1-96aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) (HIV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQAPEDQGPQREPYNEWALELLEELKNEAVRHFPRLWLHGLGQHIYNTYGDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRVRDGPGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRFN3 Protein Lysate (Mouse) with C-HA Tag
27589034 100 µg

LRFN3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CABIN1 Polyclonal Antibody
RD217760A-01 20 µL

CABIN1 Polyclonal Antibody

Sign In for Pricing
View Details
CABIN1 Polyclonal Antibody
RD217760A-02 60 μL

CABIN1 Polyclonal Antibody

Sign In for Pricing
View Details
CABIN1 Polyclonal Antibody
RD217760A-03 120 μL

CABIN1 Polyclonal Antibody

Sign In for Pricing
View Details
CABIN1 Polyclonal Antibody
RD217760A-04 200 µL

CABIN1 Polyclonal Antibody

Sign In for Pricing
View Details
NLE1 Human shRNA Plasmid Kit (Locus ID 54475)
TR302945 1 Kit

NLE1 Human shRNA Plasmid Kit (Locus ID 54475)

Sign In for Pricing
View Details